PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08651g04004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 784aa    MW: 86695.8 Da    PI: 5.5088
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08651g04004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.88.5e-23126227199
                               EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT- CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegD 78 
                               f+k+lt sd++++g +++p++ ae++       + +++  ++l+ +d++ + W++++iyr++++r++lt+GW+ F ++++L++gD
  Niben101Scf08651g04004.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QELMARDLHDQAWTFRHIYRGQPKRHLLTTGWSVFISSKRLCAGD 208
                               99*****************************954.5444.48******************************************* PP

                               EEEEEE-SSSEE..EEEEE-S CS
                        B3  79 fvvFkldgrsefelvvkvfrk 99 
                               +v+F +  +++ +l++++ r+
  Niben101Scf08651g04004.1 209 SVLFIR--DEKSQLLLGIKRA 227
                               *****4..4666678888765 PP

2Auxin_resp123.61.4e-40252334183
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                               aahaa+++s+F+++YnPras+seFv++++k++ka++ +vs+GmRf+m+fete+s  rr++Gt++gvsdldp+rW+ S+Wr+L+
  Niben101Scf08651g04004.1 252 AAHAAANNSPFSIFYNPRASPSEFVIPLAKYNKAMYAQVSLGMRFRMMFETEESGVRRYMGTITGVSDLDPIRWKSSQWRNLQ 334
                               79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-43114255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.5E-40118241IPR015300DNA-binding pseudobarrel domain
CDDcd100177.58E-18125226No hitNo description
SMARTSM010194.5E-21126228IPR003340B3 DNA binding domain
PROSITE profilePS5086311.97126228IPR003340B3 DNA binding domain
PfamPF023623.2E-20126227IPR003340B3 DNA binding domain
PfamPF065071.4E-35252334IPR010525Auxin response factor
SuperFamilySSF542772.31E-9649735No hitNo description
PfamPF023099.4E-10650743IPR033389AUX/IAA domain
PROSITE profilePS5174525.947657741IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
MKAPSNGYIA NSGEGDSKVM NSELWHACAG PLVSLPPIGS LVAYFPQGHS EQVAASMQKE  60
TDGIPSYPNL PSKLICMLHN VTLHADPETD EVYAQMTLQP VNKYDQEALI LSDMGLKQNR  120
QPAEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQELMARD LHDQAWTFRH  180
IYRGQPKRHL LTTGWSVFIS SKRLCAGDSV LFIRDEKSQL LLGIKRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFSIFYNPRA SPSEFVIPLA KYNKAMYAQV SLGMRFRMMF  300
ETEESGVRRY MGTITGVSDL DPIRWKSSQW RNLQVGWDES TAGERPSRVS IWDIEPVVTP  360
FYICPPPFFR PKFPKQPSFP GDESDIENAL KRGMPWISDE FGLKDAPSSI FPGLSLVQWM  420
SMQQNNHNPV AQSRLPNVLH SNIGTDDHSK ALSGATDGDA PSCSTSPSTN NFQVSPQNFL  480
TRNQGQAILV DESIVDPSQE QNKSEFRMKH ELPFSKGSEQ SKYKGNGTEN LEAASSTTSY  540
GLDSSGFNFS LPALCAEGDI QSHSRNNLPS AANIDGLTPD ALLSRDYDSG KDMQNLFSPF  600
GNTPRDIETE LSAAGINSQQ FGVPNMSYQP RCSNDLAVND NGVLNNNSWT NQTPRMRTYT  660
KVQKRGSVGR TIDVTRYKGY DELRHDLARM FGIEGQLEDP QRTEWKLVYV DHENDILLVG  720
DDPWEEFVSC VQSVKILSSA EVQQMSLDGD LGNVPVANQA SSGTDSGNAW RGHYDDNSAA  780
SFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1731935550388Auxin response factor 5
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009791842.10.0PREDICTED: auxin response factor 19-like
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLA0A103Y2650.0A0A103Y265_CYNCS; Auxin response factor
STRINGSolyc07g042260.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13022465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19